Skip to main content

ATP6V1B2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54858

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-54858

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP6V1B2(ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2) The peptide sequence was selected from the middle region of ATP6V1B2. Peptide sequence NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTLSEFYPRDSAK The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: B, brain isoform.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATP6V1B2 Antibody

Western Blot: ATP6V1B2 Antibody [NBP1-54858]

Western Blot: ATP6V1B2 Antibody [NBP1-54858]

Western Blot: ATP6V1B2 Antibody [NBP1-54858] - Positive Control: Lane 1: 80 ug mouse brain extract Primary Antibody Dilution : 1:500 Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR Bioscience Secondry Antibody Dilution : 1:20,000
Western Blot: ATP6V1B2 Antibody [NBP1-54858]

Western Blot: ATP6V1B2 Antibody [NBP1-54858]

Western Blot: ATP6V1B2 Antibody [NBP1-54858] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Applications for ATP6V1B2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATP6V1B2

ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

000 subunit, 56/58kD, isoform 2, ATP6B2ATPase, H+ transporting, lysosomal (vacuolar proton pump), beta polypeptide, ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2, Endomembrane proton pump 58 kDa subunit, H+ transporting two-sector ATPase, HO57ATP6B1B2, vacuolar H+-ATPase 56, Vacuolar proton pump subunit B 2, VATB, V-ATPase B2 subunit, V-ATPase subunit B 2, Vma2, VPP3ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B, isoform 2, V-type proton ATPase subunit B, brain isoform

Gene Symbol

ATP6V1B2

UniProt

Additional ATP6V1B2 Products

Product Documents for ATP6V1B2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ATP6V1B2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...