ATP6V1G2 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15964

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15964-100ul
NBP3-15964-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all ATP6V1G2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 40-100 of human ATP6V1G2 (NP_569730.1). AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATP6V1G2 Antibody - Azide and BSA Free

Western Blot: ATP6V1G2 AntibodyAzide and BSA Free [NBP3-15964]

Western Blot: ATP6V1G2 AntibodyAzide and BSA Free [NBP3-15964]

Western Blot: ATP6V1G2 Antibody [NBP3-15964] - Western blot analysis of extracts of various cell lines, using ATP6V1G2 antibody (NBP3-15964) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry-Paraffin: ATP6V1G2 Antibody - Azide and BSA Free [NBP3-15964]

Immunohistochemistry-Paraffin: ATP6V1G2 Antibody - Azide and BSA Free [NBP3-15964]

Immunohistochemistry-Paraffin: ATP6V1G2 Antibody [NBP3-15964] - Immunohistochemistry of paraffin-embedded mouse spinal cord using ATP6V1G2 Rabbit pAb (NBP3-15964) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ATP6V1G2 Antibody - Azide and BSA Free [NBP3-15964]

Immunohistochemistry-Paraffin: ATP6V1G2 Antibody - Azide and BSA Free [NBP3-15964]

Immunohistochemistry-Paraffin: ATP6V1G2 Antibody [NBP3-15964] - Immunohistochemistry of paraffin-embedded rat brain using ATP6V1G2 Rabbit pAb (NBP3-15964) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for ATP6V1G2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 50% glycerol, pH7.3

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATP6V1G2

ATP6V1G2 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

ATP6G2, ATPase, H+ transporting, lysosomal (vacuolar proton pump), ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2, Em:AC004181.3, subunit G2, vacuolar ATP synthase subunit G 2, vacuolar proton pump G subunit 2, Vacuolar proton pump subunit G 2, V-ATPase 13 kDa subunit 2, V-ATPase subunit G 2, Vma10, V-type proton ATPase subunit G 2

Gene Symbol

ATP6V1G2

Additional ATP6V1G2 Products

Product Documents for ATP6V1G2 Antibody - Azide and BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ATP6V1G2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.