Skip to main content

BAG2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47544

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-47544
NBP2-47544-25ul

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRNIENSDKAIKLLEHSKGAGSKTLQQNAES

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAG2 Antibody

Western Blot: BAG2 Antibody [NBP2-47544]

Western Blot: BAG2 Antibody [NBP2-47544]

Western Blot: BAG2 Antibody [NBP2-47544] - Analysis using Anti-BAG2 antibody NBP2-47544 (A) shows similar pattern to independent antibody NBP2-48541 (B).
Immunocytochemistry/ Immunofluorescence: BAG2 Antibody [NBP2-47544]

Immunocytochemistry/ Immunofluorescence: BAG2 Antibody [NBP2-47544]

Immunocytochemistry/Immunofluorescence: BAG2 Antibody [NBP2-47544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BAG2 Antibody [NBP2-47544]

Immunohistochemistry-Paraffin: BAG2 Antibody [NBP2-47544]

Immunohistochemistry-Paraffin: BAG2 Antibody [NBP2-47544] - Staining in human smooth muscle and pancreas tissues using anti-BAG2 antibody. Corresponding BAG2 RNA-seq data are presented for the same tissues.

Applications for BAG2 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BAG2

The BAG (Bcl-2-associated anthanogene) proteins are a family of chaperone regulators that modulate a number of diverse processes including proliferation, survival, stress responses, tumorigenesis, neuronal differentiation, growth arrest and apoptosis (reviewed Takayama and Reed, 2001; Doong et al, 2002, and Doukhanina et al. 2006). BAG proteins have been characterized as co-chaperones and interact with the chaperone heat shock proteins 70, both constitutive Hsc70 and inducible Hsp70. BAG proteins bind through their BAG domain to the ATPase domain of Hsc70/Hsp70, and can modulate either positively or negatively the functions of the Hsc70/Hsp70 chaperone proteins. The BAG domain has been shown to contribute to the anti-apoptotic activity of BAG-family proteins. The anti-apoptotic activities of BAG-family proteins may be dependent on their interactions with Hsc70/Asp70 and/or binding to Bcl-2. In addition to the conserved BAG domain, BAG-family proteins also contain additional domains which enable them to interact with specific target proteins or to target them to specific locations within cells. The BAG family contains at least six family members, including BAG-1 and its various isoforms [including BAG-1S , BAG-1M (RAP46/HAP46), and BAG-1L, BAG2, BAG3 (CAIR-1; Bis,), BAG4 (SODD), BAG5 and BAG6 (Scythe, BAT3). The following amino acids (aa) lengths and molecular weights (kDa) have been described for human BAG proteins (reviewed in Takayama et al, 2001 and Doong et al, 2002): BAG-1 (230 aa., 34 kDa), BAG-1S (219 aa, 29 kDa), BAG-1M (274 aa, 46 kDa), BAG-1L (345 aa, 52 kDa), BAG-2 [212 aa; 24 kDa (Arndt et al. 2005)], BAG-3 (575 aa, 74 kDa), BAG-4 (456 aa; 60 kDa), BAG-5 ([442 aa; 51 kDa (Kalia et al. 2004)], and BAG-6 (1129 aa; 150 kDa). Recognizes BAG-2; human BAG-2 migrates at 24-28 kDa on SDS-PAGE.

Alternate Names

BAG family molecular chaperone regulator 2, BAG-2, BAG-family molecular chaperone regulator-2, Bcl-2-associated athanogene 2, BCL2-associated athanogene 2, dJ417I1.2, dJ417I1.2 (BAG-family molecular chaperone regulator 2), KIAA0576, MGC149462

Gene Symbol

BAG2

Additional BAG2 Products

Product Documents for BAG2 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BAG2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...