Skip to main content

BAG5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84492

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-84492-0.1ml

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of BAG5. Peptide sequence: LSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKEL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BAG5 Antibody

Western Blot: BAG5 Antibody [NBP2-84492]

Western Blot: BAG5 Antibody [NBP2-84492]

Western Blot: BAG5 Antibody [NBP2-84492] - WB Suggested Anti-BAG5 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole CellBAG5 is supported by BioGPS gene expression data to be expressed in HeLa

Applications for BAG5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BAG5

The BAG (Bcl-2-associated anthanogene) proteins are a family of chaperone regulators that modulate a number of diverse processes including proliferation, survival, stress responses, tumorigenesis, neuronal differentiation, growth arrest and apoptosis (reviewed Takayama and Reed, 2001; Doong et al, 2002, and Doukhanina et al. 2006). BAG proteins have been characterized as co-chaperones and interact with the chaperone heat shock proteins 70, both constitutive Hsc70 and inducible Hsp70. BAG proteins bind through their BAG domain to the ATPase domain of Hsc70/Hsp70, and can modulate either positively or negatively the functions of the Hsc70/Hsp70 chaperone proteins. The BAG domain has been shown to contribute to the anti-apoptotic activity of BAG-family proteins. The anti-apoptotic activities of BAG-family proteins may be dependent on their interactions with Hsc70/Asp70 and/or binding to Bcl-2. In addition to the conserved BAG domain, BAG-family proteins also contain additional domains which enable them to interact with specific target proteins or to target them to specific locations within cells. The BAG family contains at least six family members, including BAG-1 and its various isoforms [including BAG-1S , BAG-1M (RAP46/HAP46), and BAG-1L, BAG2, BAG3 (CAIR-1; Bis,), BAG4 (SODD), BAG5 and BAG6 (Scythe, BAT3). The following amino acids (aa) lengths and molecular weights (kDa) have been described for human BAG proteins (reviewed in Takayama et al, 2001 and Doong et al, 2002): BAG-1 (230 aa., 34 kDa), BAG-1S (219 aa, 29 kDa), BAG-1M (274 aa, 46 kDa), BAG-1L (345 aa, 52 kDa), BAG-2 [212 aa; 24 kDa (Arndt et al. 2005)], BAG-3 (575 aa, 74 kDa), BAG-4 (456 aa; 60 kDa), BAG-5 ([442 aa; 51 kDa (Kalia et al. 2004)], and BAG-6 (1129 aa; 150 kDa).

Alternate Names

BAG family molecular chaperone regulator 5, BAG-5, BAG-family molecular chaperone regulator-5, Bcl-2-associated athanogene 5, BCL2-associated athanogene 5, KIAA0873

Gene Symbol

BAG5

Additional BAG5 Products

Product Documents for BAG5 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BAG5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...