BCKDHB Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84500

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84500-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all BCKDHB Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human BCKDHB. Peptide sequence: GFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BCKDHB Antibody

Western Blot: BCKDHB Antibody [NBP2-84500]

Western Blot: BCKDHB Antibody [NBP2-84500]

Western Blot: BCKDHB Antibody [NBP2-84500] - Host: Rabbit. Target Name: BCKDHB. Sample Type: Thyroid tumor lysates. Antibody Dilution: 1.0ug/ml
Western Blot: BCKDHB Antibody [NBP2-84500]

Western Blot: BCKDHB Antibody [NBP2-84500]

Western Blot: BCKDHB Antibody [NBP2-84500] - Host: Rabbit. Target: BCKDHB. Positive control (+): Human Liver (LI). Negative control (-): HepG2 Cell Lysate (HG). Antibody concentration: 1ug/ml

Applications for BCKDHB Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BCKDHB

Branched-chain keto acid dehydrogenase is a multienzyme complex associated with the inner membrane of mitochondria, andfunctions in the catabolism of branched-chain amino acids. The complex consists of multiple copies of 3 components:branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes the E1 beta subunit, and mutations therein have been associated with maple syrup urine disease(MSUD), type 1B, a disease characterized by a maple syrup odor to the urine in addition to mental and physicalretardation, and feeding problems. Alternative splicing at this locus results in transcript variants with different3' non-coding regions, but encoding the same isoform. (provided by RefSeq)

Alternate Names

2-oxoisovalerate dehydrogenase beta subunit, 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, BCKDE1B, BCKDH E1-beta, branched chain alpha-ketoacid dehydrogenase E1-beta subunit, branched chain keto acid dehydrogenase E1, beta polypeptide, Branched-chain alpha-keto acid dehydrogenase E1 component beta chain, dJ279A18.1, E1B, E1b-beta subunit of the branched-chain complex, EC 1.2.4.4, FLJ17880

Gene Symbol

BCKDHB

Additional BCKDHB Products

Product Documents for BCKDHB Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BCKDHB Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.