beta-3 Adrenergic R/ADRB3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10867

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10867-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all beta-3 Adrenergic R/ADRB3 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse beta-3 Adrenergic R/ADRB3 (NP_038490.2). Peptide sequence RSPDFRDAFRRLLCSYGGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for beta-3 Adrenergic R/ADRB3 Antibody

Western Blot: beta-3 Adrenergic R/ADRB3 Antibody [NBP3-10867]

Western Blot: beta-3 Adrenergic R/ADRB3 Antibody [NBP3-10867]

Western Blot: beta-3 Adrenergic R/ADRB3 Antibody [NBP3-10867] - Western blot analysis of beta-3 Adrenergic R/ADRB3 in Mouse Brain lysates. Antibody dilution at 1ug/ml

Applications for beta-3 Adrenergic R/ADRB3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: beta-3 Adrenergic R/ADRB3

The Beta-3 Adrenoceptor (ADRB3) is an Adrenergic Receptor that stimulates lipolysis and increases fatty acids in the blood. Stimulation of the beta-3 adrenoceptor leads to lipolysis in white adipocytes and nonshivering thermogenesis in brown fat. The beta-3 adrenoceptor has also been suggested to affect the physiological control of cardiac and vascular contractility; beta-3 adrenoceptor stimulation decreases cardiac contractility through activation of a nitric oxide synthase pathway. A variant of the beta-3 adrenoceptor, Trp64Arg, has been shown to be associated with weight gain (obesity) and susceptibility to non-insulin-dependent diabetes mellitus (NIDDM), but not with coronary artery disease. Trp64Arg variant receptor has been shown to predict a greater tendency to develop abdominal adiposity and high blood pressure with advancing age. ADRB3 has been suggested to be responsible for the negative inotropic effects of catecholamines and may be involved in pathophysiological mechanisms leading to heart failure; ADRB3 is also one of the molecular targets under active research in the treatment of obeisity. Beta-3 adrenoceptor expression has been documented in adipose, heart, and in smooth muscle of digestive and urinary tract organs (bladder, colon, small intestine, stomach, ureter). Utilization of alternate promoters and/or 3-prime untranslated regions may result in tissue-specific regulation of the expression of ADRB3. ESTs have been isolated from heart/melanocyte/uterus and placenta libraries.

Long Name

Beta-3 Adrenergic Receptor

Alternate Names

ADRB3, ADRB3R, B3AR, beta-3 AdrenergicR, beta3 AdrenergicR

Gene Symbol

ADRB3

Additional beta-3 Adrenergic R/ADRB3 Products

Product Documents for beta-3 Adrenergic R/ADRB3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for beta-3 Adrenergic R/ADRB3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.