BORIS Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87076

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87076
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all BORIS Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human BORIS. Peptide sequence: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for BORIS Antibody

Western Blot: BORIS Antibody [NBP2-87076]

Western Blot: BORIS Antibody [NBP2-87076]

Western Blot: BORIS Antibody [NBP2-87076] - WB Suggested Anti-CTCFL Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysateCTCFL is supported by BioGPS gene expression data to be expressed in Jurkat

Applications for BORIS Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BORIS

BORIS (Brother of the Regulator of Imprinted Sites) also known as CCTC-binding factor-like protein, is normally only expressed in the testis and expressed in a mutually exclusive manner with CTCF during male germ cell development. However, previous studies have shown that BORIS is abnormally activated in a wide range of human cancers. Expression of BORIS in normally BORIS-negative cells promotes cell growth that may lead to transformation. BORIS maps to the cancer-associated amplification region thought to contain an oncogene or dominant-immortalizing gene. BORIS is a candidate protein for the epigenetic reprogramming factor acting in the male germ line. BORIS is found in both the nucleus and cytoplasm.

Alternate Names

BORISHMGB1L1, BORIS-like protein, Brother of the regulator of imprinted sites, Cancer/testis antigen 27, CCCTC-binding factor, CCCTC-binding factor (zinc finger protein)-like, CT27MGC163358, CTCF paralog, CTCF-like protein, CTCF-T, dJ579F20.2, HMG-1L1, MGC169105, MGC169106, putative high mobility group protein 1-like 1, putative high mobility group protein B1-like 1, transcriptional repressor CTCFL, Zinc finger protein CTCF-T

Gene Symbol

CTCFL

Additional BORIS Products

Product Documents for BORIS Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for BORIS Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.