Bub3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58206

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-58206
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all Bub3 Antibodies »

Product Summary for Bub3 Antibody

Immunogen

Synthetic peptides corresponding to BUB3(BUB3 budding uninhibited by benzimidazoles 3 homolog (yeast)) The peptide sequence was selected from the N terminal of BUB3 (NP_001007794). Peptide sequence MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Bub3 Antibody

Western Blot: Bub3 Antibody [NBP1-58206]

Western Blot: Bub3 Antibody [NBP1-58206]

Western Blot: Bub3 Antibody [NBP1-58206] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml BUB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.
Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-58206]

Immunocytochemistry/ Immunofluorescence: Bub3 Antibody [NBP1-58206]

Immunocytochemistry/Immunofluorescence: Bub3 Antibody [NBP1-58206] - HCT116 Primary Antibody Dilution: 4 ug/ml Secondary Antibody : Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml
Immunohistochemistry: Bub3 Antibody [NBP1-58206]

Immunohistochemistry: Bub3 Antibody [NBP1-58206]

Immunohistochemistry: Bub3 Antibody [NBP1-58206] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Nucleus Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
View 1 more images

Applications for Bub3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Bub3

BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Long Name

BUB3 Budding Uninhibited By Benzimidazoles 1 Homolog

Alternate Names

BUB3 (budding uninhibited by benzimidazoles 3, yeast) homolog, BUB3 budding uninhibited by benzimidazoles 3 homolog, BUB3L, budding uninhibited by benomyl, budding uninhibited by benzimidazoles 3 homolog (yeast), hBUB3, mitotic checkpoint component, mitotic checkpoint protein BUB3

Entrez Gene IDs

9184 (Human)

Gene Symbol

BUB3

UniProt

O43684

Additional Bub3 Products

Product Documents for Bub3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Bub3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.