c-Myc-responsive protein Rcl Antibody (7C1Z8)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16115

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16115-100ul
NBP3-16115-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7C1Z8

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all c-Myc-responsive protein Rcl Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 75-174 of human c-Myc-responsive protein Rcl (O43598). LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Western blot analysis of extracts of various cell lines, using c-Myc-responsive protein Rcl antibody (NBP3-16115) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Immunocytochemistry/Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Immunofluorescence analysis of NIH/3T3 cells using c-Myc-responsive protein Rcl Rabbit mAb (NBP3-16115) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]

Immunocytochemistry/Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Immunofluorescence analysis of MCF7 cells using c-Myc-responsive protein Rcl Rabbit mAb (NBP3-16115) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Applications for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: c-Myc-responsive protein Rcl

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Alternate Names

chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, rcl, RP3-330M21.3

Gene Symbol

DNPH1

Additional c-Myc-responsive protein Rcl Products

Product Documents for c-Myc-responsive protein Rcl Antibody (7C1Z8)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for c-Myc-responsive protein Rcl Antibody (7C1Z8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.