c-Myc-responsive protein Rcl Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85180

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85180
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all c-Myc-responsive protein Rcl Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for c-Myc-responsive protein Rcl Antibody

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.
Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180]

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
View 3 more images

Applications for c-Myc-responsive protein Rcl Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Myc-responsive protein Rcl

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Alternate Names

chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, rcl, RP3-330M21.3

Gene Symbol

DNPH1

Additional c-Myc-responsive protein Rcl Products

Product Documents for c-Myc-responsive protein Rcl Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for c-Myc-responsive protein Rcl Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.