Calpastatin Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92941

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-92941-0.02ml
NBP2-92941-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Calpastatin Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 510-610 of human Calpastatin (NP_001177371.1). QNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Calpastatin Antibody - BSA Free

Western Blot: Calpastatin AntibodyBSA Free [NBP2-92941]

Western Blot: Calpastatin AntibodyBSA Free [NBP2-92941]

Western Blot: Calpastatin Antibody [NBP2-92941] - Analysis of extracts from normal (control) and CAST knockout (KO) HeLa cells, using Calpastatin antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% non fat dry milk TBST. Detection: ECL Basic Kit . Exposure time: 5s
Western Blot: Calpastatin AntibodyBSA Free [NBP2-92941]

Western Blot: Calpastatin AntibodyBSA Free [NBP2-92941]

Western Blot: Calpastatin Antibody [NBP2-92941] - Analysis of extracts of various cell lines, using Calpastatin at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

Applications for Calpastatin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS with 50% glycerol, pH7.3.

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Calpastatin

The calpain system has been detected in every vertebrate tissue examined, and has been suggested to play a regulatory role in cellular protein metabolism. This regulatory role may have important implications in platelet aggregation and pathologies associated with altered calcium homeostasis and protein metabolism such as ischemic cell injury and degenerative diseases. Inhibitors of calpain have been shown to block dexamethasone and low-level irradiation induced apoptosis in thymocytes suggesting that calpain has a regulatory or mechanistic role in apoptotic cell death.Calpastatin, a specific endogenous inhibitor of calpain, has a predicted molecular weight of ~77 kDa and an internal repeat of four homologous domains which allow it to inhibit multiple calpain molecules simultaneously. It functions by binding to calpain when calpain binds calcium. When Calpastatin is subjected to proteolytic digestion, fragments of calpastatin as small as 15 kDa still retain inhibitory activity.

Alternate Names

BS-17, Calpain inhibitor, calpastatin, MGC9402, Sperm BS-17 component

Gene Symbol

CAST

Additional Calpastatin Products

Product Documents for Calpastatin Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Calpastatin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.