Calumenin Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87120

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87120
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Calumenin Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Calumenin. Peptide sequence: SDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Calumenin Antibody

Western Blot: Calumenin Antibody [NBP2-87120]

Western Blot: Calumenin Antibody [NBP2-87120]

Western Blot: Calumenin Antibody [NBP2-87120] - WB Suggested Anti-CALU Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue. Observed Staining: Cytoplasm in follicular cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

Applications for Calumenin Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calumenin

The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Alternate Names

calumenin, crocalbin, crocalbin-like protein, FLJ90608, IEF SSP 9302, multiple EF-hand protein

Gene Symbol

CALU

Additional Calumenin Products

Product Documents for Calumenin Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Calumenin Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.