Carbonic Anhydrase III/CA3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88228

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88228
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Carbonic Anhydrase III/CA3 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 24743550)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Carbonic Anhydrase III/CA3 Antibody

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Analysis using Anti-CA3 antibody NBP1-88228 (A) shows similar pattern to independent antibody NBP1-88227 (B).
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Staining in human skeletal muscle and skin tissues using anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228]

Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
View 2 more images

Applications for Carbonic Anhydrase III/CA3 Antibody

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Carbonic Anhydrase III/CA3

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Alternate Names

CA3

Gene Symbol

CA3

Additional Carbonic Anhydrase III/CA3 Products

Product Documents for Carbonic Anhydrase III/CA3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Carbonic Anhydrase III/CA3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.