Casein Kinase 1 alpha Antibody (9O4L9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16807

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16807-100ul
NBP3-16807-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9O4L9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Casein Kinase 1 alpha Antibodies »

Product Summary for Casein Kinase 1 alpha Antibody (9O4L9)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 238-337 of human Casein Kinase 1 alpha (P48729). EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Casein Kinase 1 alpha Antibody (9O4L9)

Western Blot: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807]

Western Blot: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807]

Western Blot: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807] - Western blot analysis of extracts of various cell lines, using Casein Kinase 1 alpha (Casein Kinase 1 alpha) Rabbit mAb (NBP3-16807) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807]

Immunohistochemistry-Paraffin: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807]

Immunohistochemistry-Paraffin: Casein Kinase 1 alpha Antibody (9O4L9) [NBP3-16807] - Immunohistochemistry of paraffin-embedded rat liver using Casein Kinase 1 alpha (Casein Kinase 1 alpha) Rabbit mAb (NBP3-16807) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Casein Kinase 1 alpha Antibody (9O4L9)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Casein Kinase 1 alpha

Casein kinase I (also designated CKI) and casein kinase II (CKII) compose a family of serine/threonine protein kinases which are present in all eukaryotes examined to date. Casein kinase I family members, which include casein kinase Ialpha, Igamma, Idelta and Iepisilon, have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. CKII is usually expressed as a tetrameric complex consisting of either an alpha2beta2 or an alphaalpha'beta2 structure. The a catalytic subunit is stimulated by the beta regulatory subunit, which undergoes autophosphorylation. Casein kinase II activity is high in the cytosol and nucleus of proliferating and differentiating cells. Casein kinase II is known to phosphorylate more than 100 different substrates including nuclear oncoproteins, transcription factors and enzymes involved in DNA metabolism.

Alternate Names

CSNK1A1, HLCDGP1

Gene Symbol

CSNK1A1

Additional Casein Kinase 1 alpha Products

Product Documents for Casein Kinase 1 alpha Antibody (9O4L9)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Casein Kinase 1 alpha Antibody (9O4L9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.