Caveolin-1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-54737

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-54737
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all Caveolin-1 Antibodies »

Product Specifications

Immunogen

This antibody was developed against a Recombinant Protein corresponding to amino acids: LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Caveolin-1 Antibody

Western Blot: Caveolin-1 Antibody [NBP2-54737]

Western Blot: Caveolin-1 Antibody [NBP2-54737]

Western Blot: Caveolin-1 Antibody [NBP2-54737] - Analysis in human cell line A-431 and human cell line CACO-2.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Analysis in human lung and pancreas tissues. Corresponding CAV1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737]

Immunohistochemistry-Paraffin: Caveolin-1 Antibody [NBP2-54737] - Staining of human liver shows moderate membranous positivity in hepatic sinusoid cells.
View 3 more images

Applications for Caveolin-1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Caveolin-1

Caveolae are specialized domains of the plasma membrane that are implicated in the sequestration of a variety of lipid and protein molecules. It has been suggested that these important cellular organelles have a pivotal role in such diverse biochemical processes as lipid metabolism, growth regulation, signal transduction, and apoptosis. Caveolin interacts with and regulates heterotrimeric G-proteins. Currently, there are three members of the caveolin multigene family which are known to encode 21-24 kDa integral membrane proteins that comprise the major structural component of the caveolar membrane in vivo. Caveolin-2 protein is abundantly expressed in fibroblasts and differentiated adipocytes, smooth and skeletal muscle, and endothelial cells. The expression of caveolin-1 is similar to that of caveolin-2 while caveolin-3 expression appears to be limited to muscle tissue types.

Alternate Names

CAV1, Caveolin1, MSTP085, VIP21

Gene Symbol

CAV1

Additional Caveolin-1 Products

Product Documents for Caveolin-1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Caveolin-1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.