CDC26 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84639

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84639-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all CDC26 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDC26. Peptide sequence: NIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CDC26 Antibody

Western Blot: CDC26 Antibody [NBP2-84639]

Western Blot: CDC26 Antibody [NBP2-84639]

Western Blot: CDC26 Antibody [NBP2-84639] - Lanes: 1: 20ug Jukart cell lysate, 2: 20ug untransfected Hela lysate, 3: 20ug GFP-STAMBP transfected HeLa lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit-HRP. Secondary Antibody Dilution: 1:2000. Gene Name: CDC26. Submitted by: Dr. N. Blake, University of Liverpool.
Western Blot: CDC26 Antibody [NBP2-84639]

Western Blot: CDC26 Antibody [NBP2-84639]

Western Blot: CDC26 Antibody [NBP2-84639] - WB Suggested Anti-CDC26 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: A549 cell lysate

Applications for CDC26 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDC26

The protein encoded by the CDC26 gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycleanaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cellcycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of variousproteins. (provided by RefSeq)

Alternate Names

ANAPC12chromosome 9 open reading frame 17, Anaphase-promoting complex subunit 12, anaphase-promoting complex subunit CDC26, APC12anaphase promoting complex subunit 12, C9orf17, CDC26 subunit of anaphase promoting complex, cell division cycle 26, cell division cycle 26 homolog (S. cerevisiae), Cell division cycle protein 26 homolog

Gene Symbol

CDC26

Additional CDC26 Products

Product Documents for CDC26 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CDC26 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.