CDX4 Antibody (2H7)

Novus Biologicals, part of Bio-Techne | Catalog # H00001046-M11

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00001046-M11
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2H7

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all CDX4 Antibodies »

Product Specifications

Immunogen

CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

CDX4 (2H7)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CDX4 Antibody (2H7)

Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Raw 264.7 (Cat # L024V1).
Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in PC-12 (Cat # L012V1).
Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11]

Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Hela S3 NE (Cat # L013V3).

Applications for CDX4 Antibody (2H7)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CDX4

The caudal-type homeobox protein family of transcription factors are involved in early anteroposterior patterning by regulating members of the HOX gene family. CDX proteins contain a caudal-like activation domain and a DNA-binding homeodomain. CDX2 promotes intestinal patterning and development, while CDX4 regulates hematopoiesis and proliferation and differentiation of epithelial lining in the gut. Caudal homologs are associated with various diseases including cancers of the gut epithelium.

Long Name

Caudal-type Homeobox Transcription Factor 4

Alternate Names

caudal type homeo box transcription factor 4, caudal type homeobox 4, caudal type homeobox transcription factor 4, Caudal-type homeobox protein 4, homeobox protein CDX-4

Entrez Gene IDs

1046 (Human)

Gene Symbol

CDX4

OMIM

300025 (Human)

UniProt

NP_005184 (Human)

Additional CDX4 Products

Product Documents for CDX4 Antibody (2H7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CDX4 Antibody (2H7)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.