CHMP4B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87183

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87183
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all CHMP4B Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHMP4B. Peptide sequence: EEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CHMP4B Antibody

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target Name: CHMP4B. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183]

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183]

Immunohistochemistry-Paraffin: CHMP4B Antibody [NBP2-87183] - Rabbit Anti-CHMP4B antibody. Formalin Fixed Paraffin Embedded Tissue: Human Kidney. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183]

Western Blot: CHMP4B Antibody [NBP2-87183] - Host: Rabbit. Target Name: CHMP4B. Sample Tissue: Human Hela. Antibody Dilution: 1.0ug/ml
View 3 more images

Applications for CHMP4B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHMP4B

Component of the escrt-iii complex, which is required for multivesicular bodies (mvbs) formation and sorting of endosomal cargo proteins into mvbs. the mvb pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. the escrt-iii complex is probably involved in the concentration of mvb cargo. in the escrt-iii complex, it probably serves as an acceptor for escrt-i complex on endosomal membranes. in case of infection, the hiv-1 virus takes advantage of the escrt-iii complex for budding and exocytic cargos of viral proteins, via the association of chmp4 proteins with pdcd6ip/aip1, a protein directly recruited by hiv-1 p6 protein that functions at sites of viral gag assembly and budding.

Alternate Names

C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, SHAX1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B

Gene Symbol

CHMP4B

Additional CHMP4B Products

Product Documents for CHMP4B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CHMP4B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.