CIAO1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84682

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84682-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all CIAO1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CIAO1. Peptide sequence: SVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CIAO1 Antibody

Western Blot: CIAO1 Antibody [NBP2-84682]

Western Blot: CIAO1 Antibody [NBP2-84682]

Western Blot: CIAO1 Antibody [NBP2-84682] - Host: Rabbit. Target Name: CIAO1. Sample Type: MCF7. Antibody Dilution: 1.0ug/mlCIAO1 is supported by BioGPS gene expression data to be expressed in MCF7
Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP2-84682]

Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP2-84682]

Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP2-84682] - Rabbit Anti-CIAO1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue. Observed Staining: Cytoplasmic in alveolar type I cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1/600. Secondary Antibody: Donkey anti-Ra
Western Blot: CIAO1 Antibody [NBP2-84682]

Western Blot: CIAO1 Antibody [NBP2-84682]

Western Blot: CIAO1 Antibody [NBP2-84682] - WB Suggested Anti-CIAO1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: 721_B cell lysateCIAO1 is supported by BioGPS gene expression data to be expressed in 721_B
View 1 more images

Applications for CIAO1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CIAO1

Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins. Seems to specifically modulate the transactivation activity of WT1

Alternate Names

CIA1, cytosolic iron-sulfur protein assembly 1, cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae), probable cytosolic iron-sulfur protein assembly protein CIAO1, WD repeat domain 39, WD repeat-containing protein 39, WD40 protein Ciao1, WDR39cytosolic iron-sulfur protein assembly 1 homolog

Gene Symbol

CIAO1

Additional CIAO1 Products

Product Documents for CIAO1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CIAO1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.