Claudin-11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-10980

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-10980-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Claudin-11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Claudin-11 (NP_032796.1). Peptide sequence LLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Claudin-11 Antibody

Western Blot: Claudin-11 Antibody [NBP3-10980]

Western Blot: Claudin-11 Antibody [NBP3-10980]

Western Blot: Claudin-11 Antibody [NBP3-10980] - Western blot analysis of Claudin-11 in Mouse Pancreas lysates. Antibody dilution at 1ug/ml

Applications for Claudin-11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-11

Oligodendrocyte specific protein belongs is a major component of central nervous system myelin that is necessary for normal CNS function. The claudin superfamily consists of many structurally related proteins in humans. These proteins, which include claudin 1 through 18, and are located in both epithelial and endothelial cells in all tight junction bearing tissues. Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. There is growing evidence that the Claudin 11 protein determines the permeability between layers of myelin sheaths via focal adhesion and with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Alternate Names

Claudin11, CLDN11, OSP, OTM

Gene Symbol

CLDN11

Additional Claudin-11 Products

Product Documents for Claudin-11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Claudin-11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.