COLEC5 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98277

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-98277
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all COLEC5 Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is COLEC5 - N-terminal region. Peptide sequence PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for COLEC5 Antibody

Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277] - Lanes: Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 2: 20ug Rat bronchoalveolar lavage Lane 3: 25ng hSP-A2 variant expressed in CHO cells Lane 4: 25ng hSP-A2 variant expressed
Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277] - Human Fetal Heart Lysate, concentration 1 ug/ml.
Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277]

Western Blot: COLEC5 Antibody [NBP1-98277] - 1: 20ng human SP-A2 protein 2: 20 ug rat wt BAL lysate, 3: 25 ng hSP-A2 (1A0) protein from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein from transfected CHO lysate, 5: 25 ng hSP-A1 (6A2) protein from transfected CHO lysate, 6: 25 ng hSP-A1 (6A4) protein from transfected CHO lysate, 7: 25 ng hSP-A2/1 (1A0/6A4) protein from transfected CHO lysate, 8: 25 ng hSP-A2/1 (1A1/6A2) protein from transfected CHO lysate, 9: 20 ug SP-A KO mouse BAL lysate, 10: 25 ng hSP-A2 (1A0) protein from transfected mouse BAL lysate, 11 : 25 ng hSP-A2 (1A1) protein from transfected mouse BAL lysate, 12: 25 ng hSP-A1 (6A2) protein from transfected mouse BAL lysate, 13: 25 ng hSP-A1 (6A4) protein from transfected mouse BAL lysate, 14: 25 ng hSP-A2/1 (1A0/6A2) protein from transfected mouse BAL lysate, 15: 25 ng mouse SP-A2 protein from mouse BAL lysate ,16: 20 ug mouse wt BAL lysate, 17: 15ug human wt T2 lysate, 18: 25 ng human SP-A2 protein.

Applications for COLEC5 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COLEC5

This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

Alternate Names

COLEC5, PSAP, PSPA, PSP-A, pulmonary surfactant-associated protein A2, SFTP1, SFTPA2B, SP-A, SPA2, SPAII, surfactant protein A2

Gene Symbol

SFTPA2

UniProt

NP_001092138 (Human)

Additional COLEC5 Products

Product Documents for COLEC5 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for COLEC5 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.