COX7A1 Antibody - Azide and BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-92185
![Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]](https://resources.bio-techne.com/images/products/COX7A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92185-img0002.jpg "Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]")
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1). MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for COX7A1 Antibody - Azide and BSA Free
![Western Blot: COX7A1 AntibodyAzide and BSA Free [NBP2-92185]](https://resources.bio-techne.com/images/products/COX7A1 Antibody-Western Blot-NBP2-92185-img0004.jpg "Western Blot: COX7A1 AntibodyAzide and BSA Free [NBP2-92185]")
Western Blot: COX7A1 AntibodyAzide and BSA Free [NBP2-92185]
Western Blot: COX7A1 Antibody [NBP2-92185] - Western blot analysis of extracts of Mouse heart, using COX7A1 antibody (NBP2-92185) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.![Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]](https://resources.bio-techne.com/images/products/COX7A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92185-img0003.jpg "Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]")
Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]
Immunohistochemistry-Paraffin: COX7A1 Antibody [NBP2-92185] - Immunohistochemistry of paraffin-embedded Human skeletal muscle using COX7A1 Rabbit pAb (NBP2-92185) at dilution of 1:50 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.![Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]](https://resources.bio-techne.com/images/products/COX7A1-Antibody-Immunohistochemistry-Paraffin-NBP2-92185-img0001.jpg "Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]")
Immunohistochemistry-Paraffin: COX7A1 Antibody - Azide and BSA Free [NBP2-92185]
Immunohistochemistry-Paraffin: COX7A1 Antibody [NBP2-92185] - Immunohistochemistry of paraffin-embedded mouse heart using COX7A1 Rabbit pAb (NBP2-92185) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.Applications for COX7A1 Antibody - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:100 - 1:500
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS with 50% glycerol, pH7.3.
Format
Azide and BSA Free
Preservative
0.05% Proclin 300
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: COX7A1
Alternate Names
COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial
Gene Symbol
COX7A1
Additional COX7A1 Products
Product Documents for COX7A1 Antibody - Azide and BSA Free
Product Specific Notices for COX7A1 Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...