CXXC1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-84739

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-84739-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all CXXC1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXXC1. Peptide sequence: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CXXC1 Antibody

Western Blot: CXXC1 Antibody [NBP2-84739]

Western Blot: CXXC1 Antibody [NBP2-84739]

Western Blot: CXXC1 Antibody [NBP2-84739] - WB Suggested Anti-CXXC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739] - Rabbit Anti-CXXC1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skin. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739] - Rabbit Anti-CXXC1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Applications for CXXC1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CXXC1

Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 (PubMed 11604496)).(supplied by OMIM)

Alternate Names

CFP1CXXC-type zinc finger protein 1, CGBPPHD finger and CXXC domain-containing protein 1, CpG binding protein, cpG-binding protein, CXXC finger 1 (PHD domain), CXXC finger protein 1, DNA-binding protein with PHD finger and CXXC domain, hCGBP, HsT2645, PCCX12410002I16Rik, PHF185830420C16Rik, SPP1, ZCGPC1, zinc finger, CpG binding-type containing 1

Gene Symbol

CXXC1

Additional CXXC1 Products

Product Documents for CXXC1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CXXC1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.