CYP11A1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54758

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54758
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all CYP11A1 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP11A1. Peptide Sequence LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CYP11A1 Antibody

Western Blot: CYP11A1 Antibody [NBP1-54758]

Western Blot: CYP11A1 Antibody [NBP1-54758]

Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CYP11A1 Antibody [NBP1-54758]

Immunohistochemistry: CYP11A1 Antibody [NBP1-54758]

Immunohistochemistry: CYP11A1 Antibody [NBP1-54758] - Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody
Western Blot: CYP11A1 Antibody [NBP1-54758]

Western Blot: CYP11A1 Antibody [NBP1-54758]

Western Blot: CYP11A1 Antibody [NBP1-54758] - CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.
View 5 more images

Applications for CYP11A1 Antibody

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP11A1

CYP11A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP11A1 localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.

Alternate Names

Cholesterol desmolase, cholesterol monooxygenase (side-chain-cleaving), cholesterol side-chain cleavage enzyme, mitochondrial, CYPXIA1, Cytochrome P450 11A1, Cytochrome P450(scc), cytochrome P450, family 11, subfamily A, polypeptide 1, cytochrome P450C11A1, EC 1.14.15, EC 1.14.15.6, steroid 20-22-lyase, subfamily XIA (cholesterol side chain cleavage)

Gene Symbol

CYP11A1

UniProt

P05108 (Human)

Additional CYP11A1 Products

Product Documents for CYP11A1 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for CYP11A1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.