Cytochrome P450 4A Antibody (10D10W7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15847

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15847-100ul
NBP3-15847-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10D10W7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Cytochrome P450 4A Antibodies »

Product Summary for Cytochrome P450 4A Antibody (10D10W7)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cytochrome P450 4A (CYP4A11) (Q02928). QFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytochrome P450 4A Antibody (10D10W7)

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Western Blot: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Western blot analysis of extracts of various cell lines, using Cytochrome P450 4A (CYP4A11) Rabbit mAb (NBP3-15847) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Immunohistochemistry of paraffin-embedded mouse kidney using Cytochrome P450 4A (CYP4A11) Rabbit mAb (NBP3-15847) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847]

Immunohistochemistry-Paraffin: Cytochrome P450 4A Antibody (10D10W7) [NBP3-15847] - Immunohistochemistry of paraffin-embedded rat liver using Cytochrome P450 4A (CYP4A11) Rabbit mAb (NBP3-15847) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 1 more images

Applications for Cytochrome P450 4A Antibody (10D10W7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytochrome P450 4A

Alternate Names

20-HETE synthase, CP4Y, CYP4A2, cytochrome P450 4A11, cytochrome P450, family 4, subfamily A, polypeptide 11, cytochrome P450, subfamily IVA, polypeptide 11, cytochrome P-450HK-omega, cytochrome P450HL-omega, fatty acid omega-hydroxylase, lauric acid omega-hydroxylase, P450HL-omega

Gene Symbol

CYP4A11

Additional Cytochrome P450 4A Products

Product Documents for Cytochrome P450 4A Antibody (10D10W7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytochrome P450 4A Antibody (10D10W7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.