Cytochrome P450 4F11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-69423

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-69423
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

View all Cytochrome P450 4F11 Antibodies »

Product Summary for Cytochrome P450 4F11 Antibody

Immunogen

Synthetic peptides corresponding to CYP4F11(cytochrome P450, family 4, subfamily F, polypeptide 11) The peptide sequence was selected from the N terminal of CYP4F11. Peptide sequence FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytochrome P450 4F11 Antibody

Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423]

Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423]

Western Blot: Cytochrome P450 4F11 Antibody [NBP1-69423] - This Anti-CYP4F11 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Applications for Cytochrome P450 4F11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 4F11

CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F2, is approximately 16 kb away.

Alternate Names

CYPIVF11, cytochrome P450 4F11, cytochrome P450, family 4, subfamily F, polypeptide 11, cytochrome P450, subfamily IVF, polypeptide 11, EC 1.14.14.1

Gene Symbol

CYP4F11

UniProt

Q9HBI6 (Human)

Additional Cytochrome P450 4F11 Products

Product Documents for Cytochrome P450 4F11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytochrome P450 4F11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.