Cytokeratin 6 Antibody (3F7A1)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15324

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15324-100ul
NBP3-15324-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3F7A1

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Cytokeratin 6 Antibodies »

Product Summary for Cytokeratin 6 Antibody (3F7A1)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (P48668). YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 6 Antibody (3F7A1)

Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]

Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]

Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324] - Western blot analysis of extracts of various cell lines, using Cytokeratin 6 (KRT6) Rabbit mAb (NBP3-15324) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]

Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]

Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324] - Immunohistochemistry of paraffin-embedded human esophageal using Cytokeratin 6 (KRT6) Rabbit mAb (NBP3-15324) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Cytokeratin 6 Antibody (3F7A1)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 6

Keratins 6 and 16 are expressed in keratinocytes, which are undergoing rapid turnover in the suprabasal region (also known as hyperproliferation related keratins). Keratin 6 is found in hair follicles, neck squamous cell carcinomas, suprabasal cells of a variety of internal stratified epithelia, in epidermis, in both normal and hyperproliferative situations. Epidermal injury results in activation of keratinocytes which express CK6 and CK16. CK6 is strongly expressed in about 75% of head and neck squamous cell carcinomas. Expression of CK6 is particularly associated with differentiation. There are at least six isoforms of human type II keratin 6 (K6), K6A being the most abundant representing about 77% of all forms found in epithelia.

Alternate Names

Allergen Hom s 5, CK6A, CK-6A, CK6C, CK6D, CK-6D, cytokeratin 6A, cytokeratin 6C, cytokeratin 6D, Cytokeratin-6A, Cytokeratin-6D, K6A, K6C, K6D, keratin 6A, keratin 6C, keratin 6D, keratin, epidermal type II, K6A, keratin, type II cytoskeletal 6A, Keratin-6A, KRT6C, KRT6D, Type-II keratin Kb6

Gene Symbol

KRT6A

Additional Cytokeratin 6 Products

Product Documents for Cytokeratin 6 Antibody (3F7A1)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Cytokeratin 6 Antibody (3F7A1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.