DDX23 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58799

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58799
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all DDX23 Antibodies »

Product Summary for DDX23 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX23 Antibody

Western Blot: DDX23 Antibody [NBP2-58799]

Western Blot: DDX23 Antibody [NBP2-58799]

Western Blot: DDX23 Antibody [NBP2-58799] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: DDX23 Antibody [NBP2-58799]

Immunocytochemistry/ Immunofluorescence: DDX23 Antibody [NBP2-58799]

Immunocytochemistry/Immunofluorescence: DDX23 Antibody [NBP2-58799] - Staining of human cell line HeLa shows localization to nucleus & nucleoli.

Applications for DDX23 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDX23

DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the U5 snRNP complex; it may facilitate conformational changes in the spliceosome during nuclear pre-mRNA splicing. An alternatively spliced transcript variant has been found for this gene, but its biological validity has not been determined.

Alternate Names

100 kDa U5 snRNP-specific protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 23, DEAD box protein 23, EC 3.6.1, EC 3.6.4.13, MGC8416, probable ATP-dependent RNA helicase DDX23, PRP28, PRP28 homolog, PRP28 homolog, yeast, PRP28p homolog, PRPF28, U5 snRNP 100 kD protein, U5-100K, U5-100KD

Gene Symbol

DDX23

Additional DDX23 Products

Product Documents for DDX23 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DDX23 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.