DEFA6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-84281

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-84281
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Simple Western, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all DEFA6 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DEFA6 Antibody

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine and cerebral cortex tissues using NBP1-84281 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine and cerebral cortex tissues using NBP1-84281 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.
Western Blot: DEFA6 Antibody [NBP1-84281]

Western Blot: DEFA6 Antibody [NBP1-84281]

Western Blot: DEFA6 Antibody [NBP1-84281] - Analysis in human small intestine tissue.
Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281]

Immunohistochemistry-Paraffin: DEFA6 Antibody [NBP1-84281] - Staining of human duodenum shows cytoplasmic positivity in Paneth cells.
View 5 more images

Applications for DEFA6 Antibody

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEFA6

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8. The protein encoded by this gene, defensin, alpha 6, is highly expressed in the secretory granules of Paneth cells of the small intestine, and likely plays a role in host defense of human bowel. [provided by RefSeq]

Alternate Names

DEF6HD-6, defensin 6, Defensin, alpha 6, defensin, alpha 6, Paneth cell-specific, defensin-6

Gene Symbol

DEFA6

Additional DEFA6 Products

Product Documents for DEFA6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DEFA6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.