DNA Polymerase beta Antibody (6M8I5)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16127

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16127-100ul
NBP3-16127-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6M8I5

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all DNA Polymerase beta Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 236-335 of human DNA Polymerase beta (P06746). MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for DNA Polymerase beta Antibody (6M8I5)

Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Western Blot: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Western blot analysis of extracts of various cell lines, using DNA Polymerase beta Rabbit mAb (NBP3-16127) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Immunohistochemistry of paraffin-embedded mouse testis using DNA Polymerase beta Rabbit mAb (NBP3-16127) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127]

Immunohistochemistry-Paraffin: DNA Polymerase beta Antibody (6M8I5) [NBP3-16127] - Immunohistochemistry of paraffin-embedded rat testis using DNA Polymerase beta Rabbit mAb (NBP3-16127) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for DNA Polymerase beta Antibody (6M8I5)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DNA Polymerase beta

DNA polymerase beta comprises an amino terminal 8kDa domain and a carboxy terminal 31kDa domain. DNA Polymerase beta, a DNA repair polymerase is constitutively expressed in cultured cells. DNA polymerase beta fills single nucleotide gaps in DNA produced by the base excision repair pathway of mammalian cells.

Alternate Names

POLB

Gene Symbol

POLB

Additional DNA Polymerase beta Products

Product Documents for DNA Polymerase beta Antibody (6M8I5)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DNA Polymerase beta Antibody (6M8I5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.