DNAJB6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-54951

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-54951
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all DNAJB6 Antibodies »

Product Summary for DNAJB6 Antibody

Immunogen

Synthetic peptides corresponding to DNAJB6(DnaJ (Hsp40) homolog, subfamily B, member 6) The peptide sequence was selected from the N terminal of DNAJB6. Peptide sequence PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DNAJB6 Antibody

Western Blot: DNAJB6 Antibody [NBP1-54951]

Western Blot: DNAJB6 Antibody [NBP1-54951]

Western Blot: DNAJB6 Antibody [NBP1-54951] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for DNAJB6 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB6

DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Alternate Names

DJ4, DKFZp566D0824, DnaJ, DnaJ (Hsp40) homolog, subfamily B, member 6, dnaJ homolog subfamily B member 6, DnaJ-like 2 protein, FLJ42837, Heat shock protein J2, HHDJ1, HSJ2, HSJ-2, MGC1152, MRJMGC117297, MSJ1, MSJ-1

Gene Symbol

DNAJB6

UniProt

O75190 (Human)

Additional DNAJB6 Products

Product Documents for DNAJB6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DNAJB6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.