DNAJB6 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49286

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49286
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all DNAJB6 Antibodies »

Product Summary for DNAJB6 Antibody

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJB6 Antibody

Western Blot: DNAJB6 Antibody [NBP2-49286]

Western Blot: DNAJB6 Antibody [NBP2-49286]

Western Blot: DNAJB6 Antibody [NBP2-49286] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
Immunocytochemistry/ Immunofluorescence: DNAJB6 Antibody [NBP2-49286]

Immunocytochemistry/ Immunofluorescence: DNAJB6 Antibody [NBP2-49286]

Immunocytochemistry/Immunofluorescence: DNAJB6 Antibody [NBP2-49286] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286]

Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286]

Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts, Leydig cells.

Applications for DNAJB6 Antibody

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB6

DNAJB6 encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Alternate Names

DJ4, DKFZp566D0824, DnaJ, DnaJ (Hsp40) homolog, subfamily B, member 6, dnaJ homolog subfamily B member 6, DnaJ-like 2 protein, FLJ42837, Heat shock protein J2, HHDJ1, HSJ2, HSJ-2, MGC1152, MRJMGC117297, MSJ1, MSJ-1

Gene Symbol

DNAJB6

Additional DNAJB6 Products

Product Documents for DNAJB6 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for DNAJB6 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.