DUSP11 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87311

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87311
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all DUSP11 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse DUSP11. Peptide sequence: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for DUSP11 Antibody

Western Blot: DUSP11 Antibody [NBP2-87311]

Western Blot: DUSP11 Antibody [NBP2-87311]

Western Blot: DUSP11 Antibody [NBP2-87311] - Host: Rabbit. Target Name: Dusp11. Sample Type: Mouse Testis lysates. Antibody Dilution: 1.0ug/ml

Applications for DUSP11 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DUSP11

DUSP11 is encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. [provided by RefSeq]

Alternate Names

dual specificity phosphatase 11 (RNA/RNP complex 1-interacting), Dual specificity protein phosphatase 11, EC 3.1.3.-, Phosphatase that interacts with RNA/RNP complex 1, PIR1RNA/RNP complex-interacting phosphatase, RNA/RNP complex-1-interacting phosphatase, serine/threonine specific protein phosphatase

Gene Symbol

DUSP11

Additional DUSP11 Products

Product Documents for DUSP11 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DUSP11 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.