Dynein heavy chain Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82938

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82938-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Dynein heavy chain Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Dynein heavy chain. Peptide sequence: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Dynein heavy chain Antibody

Western Blot: Dynein heavy chain Antibody [NBP2-82938]

Western Blot: Dynein heavy chain Antibody [NBP2-82938]

Western Blot: Dynein heavy chain Antibody [NBP2-82938] - WB Suggested Anti-DNAH9 Antibody. Titration: 1.0 ug/ml. Positive Control: Placenta
Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938]

Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938]

Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938] - Sample Type: mouse tracheal epithelial cells. Primary Antibody Dilution: 1:50. Secondary Antibody: Anti-rabbit alexa 488. Secondary Antibody Dilution: 1:1000. Gene Name: DNAH9. Submitted by: Lee, Yin Loon
Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938]

Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938]

Immunohistochemistry: Dynein heavy chain Antibody [NBP2-82938] - Sample Type: mouse tracheal epithelial cells. Primary Antibody Dilution: 1:50. Secondary Antibody: Anti-rabbit alexa 488. Secondary Antibody Dilution: 1:1000. Gene Name: DNAH9. Submitted by: Lee, Yin Loon

Applications for Dynein heavy chain Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dynein heavy chain

Dynein heavy chain 9, axonemal is a protein that has three isoforms, with lengths of 4486, 4410, and 798 amino acids and weights of approximately 512, 503, and 798 kDa respectively. Dynein heavy chain generates force at the minus end of the microtubules that make up cilia which occurs due to the use of ADP that dynein obtains through ATPase activity. Current research is being done on diseases and disorders linked to this protein including ciliary dyskinesia, Kartagener syndrome, bronchiectasis, and malaria. Dynein heavy chain has also been shown to have interactions with BCL6, DNAH1, DNAH17, DNAH2, and DNAH3 in pathways such as the cytoplasmic microtubules pathway.

Alternate Names

axonemal, heavy polypeptide 9, ciliary dynein heavy chain 9, DNAH9 variant protein, DYH9, dynein heavy chain 9, axonemal, dynein, axonemal, heavy chain 9, HL20

Gene Symbol

DNAH9

Additional Dynein heavy chain Products

Product Documents for Dynein heavy chain Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Dynein heavy chain Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.