E2F3 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80295

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-80295
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all E2F3 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human E2F3. Peptide sequence LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for E2F3 Antibody

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Mouse. Target Name: E2F3. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295]

Western Blot: E2F3 Antibody [NBP1-80295] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
View 2 more images

Applications for E2F3 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: E2F3

E2F3 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Alternate Names

DKFZp686C18211, E2F transcription factor 3, E2F-3, KIAA0075, MGC104598, transcription factor E2F3

Entrez Gene IDs

1871 (Human)

Gene Symbol

E2F3

UniProt

CAH18140 (Human)

Additional E2F3 Products

Product Documents for E2F3 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for E2F3 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.