EIF3B Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87341

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87341
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all EIF3B Antibodies »

Product Summary for EIF3B Antibody

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human EIF3B. Peptide sequence: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EIF3B Antibody

Western Blot: EIF3B Antibody [NBP2-87341]

Western Blot: EIF3B Antibody [NBP2-87341]

Western Blot: EIF3B Antibody [NBP2-87341] - WB Suggested Anti-EIF3S9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysateEIF3B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341]

Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341]

Immunohistochemistry-Paraffin: EIF3B Antibody [NBP2-87341] - Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue. Observed Staining: Cytoplasm. Primary Antibody Concentration: 1:600.

Applications for EIF3B Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF3B

Eukaryotic initiation factor 3 subunit B (eIF3B) is one of at least 13 non-identical protein subunits of eukaryotic initiation factor 3 (eIF3). eIF3 is the largest eIF (~650 kDa) and functions to facilitate binding of the 40S ribosomal subunit to the 5'-end of cellular mRNAs near the cap structure (m7GpppN). eIF3B is a conserved subunit and part of the functional core of eIF3. It bears a non-canonical RNA recognition motif (RRM) and interacts directly with the eIF3S1 subunit.

Alternate Names

eIF3 p110, eIF3 p116, eIF3b, eIF-3-eta, EIF3-P110, EIF3-P116, EIF3S9EIF3-ETA, Eukaryotic translation initiation factor 3 subunit 9, eukaryotic translation initiation factor 3 subunit B, eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD), eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, eukaryotic translation initiation factor 3, subunit B, MGC104664, MGC131875, Prt1 homolog, PRT1hPrt1

Gene Symbol

EIF3B

Additional EIF3B Products

Product Documents for EIF3B Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for EIF3B Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.