EIF4A3 Antibody (6Y3N4)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16727

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16727-100ul
NBP3-16727-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6Y3N4

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all EIF4A3 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 34-125 of human EIF4A3 (P38919). VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EIF4A3 Antibody (6Y3N4)

Western Blot: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Western Blot: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Western Blot: EIF4A3 Antibody (6Y3N4) [NBP3-16727] - Western blot analysis of extracts of various cell lines, using EIF4A3 Rabbit mAb (NBP3-16727) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody (6Y3N4) [NBP3-16727]

Immunocytochemistry/Immunofluorescence: EIF4A3 Antibody (6Y3N4) [NBP3-16727] - Immunofluorescence analysis of U-2 OS cells using EIF4A3 Rabbit mAb (NBP3-16727) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for EIF4A3 Antibody (6Y3N4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: EIF4A3

EIF4A3 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family.

Alternate Names

ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34

Gene Symbol

EIF4A3

Additional EIF4A3 Products

Product Documents for EIF4A3 Antibody (6Y3N4)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for EIF4A3 Antibody (6Y3N4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.