ELF2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-87348

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-87348
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all ELF2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ELF2. Peptide sequence: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ELF2 Antibody

Western Blot: ELF2 Antibody [NBP2-87348]

Western Blot: ELF2 Antibody [NBP2-87348]

Western Blot: ELF2 Antibody [NBP2-87348] - Host: Mouse. Target Name: ELF2. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348] - Rabbit Anti-ELF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skin. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Western Blot: ELF2 Antibody [NBP2-87348]

Western Blot: ELF2 Antibody [NBP2-87348]

Western Blot: ELF2 Antibody [NBP2-87348] - WB Suggested Anti-ELF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate
View 2 more images

Applications for ELF2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ELF2

soform 1 transcriptionally activates the LYN and BLK promoters and acts synergistically with RUNX1 to transactivate the BLK promoter .Isoform 2 may function in repression of RUNX1-mediated transactivation

Alternate Names

b, E74-like factor 2, E74-like factor 2 (ets domain transcription factor), ets family transcription factor ELF2C, ETS-related transcription factor Elf-2, NERF-1a, NERF-1B, NERF-2, NERFEU32, New ETS-related factor

Gene Symbol

ELF2

Additional ELF2 Products

Product Documents for ELF2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ELF2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.