Enolase came up as a candidate in mass spec. There are at least three isoforms which showed up once or twice or three times (as in three mass spec repeats). To validate the mass data, we are looking into quantitate each isoform. Which antibodies are specific for each of the three?

Name: Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free
Brand: Novus Biologicals
SKU: NBP2-50532

We checked all antibodies to Enolase 1, Enolase 2 and Enolase 3, but unfortunately no cross reactivity testing was performed for any of these antibodies. Considering how similar these proteins are, it is reasonable to expect some of them will react with other enolases. Base on immunogen sequence, we found some that were raised to the most diverse regions between these proteins, so it is possible that these will be the most specific to the protein they were raised to. For Enolase 1, your best bet is NBP2-25147 as it was raised to N terminal peptide of bovine Eno1: MSILKVHAREIF For Enolase 2, I found 3 candidate antibodies: NBP2-53158 and NBP2-50532 were raised to aa416-433 (ELGDEARFAGHNFRNPSVL) - it says these antibodies are only reactive with human but they will also work for mouse since the immunogen is 100% match NBP2-50533, which was raised to aa271-285 (GDQLGALYQDFVRD) - which is also likely to react with mouse, the immunogen is 93% match with mouse (only last aminoacid is different) For Enolase 3, your best bet would be H00002027-M01 or H00002027-A01. both were raised to aa228-277 (KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG) - 98% match to mouse The immunogens for all these antibodies fall into most variable regions, however, since we have not performed crossreactivity testing, we can not guarantee that they will not crossreact to some extent.

Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-50532

Submit a review

Product Datasheet / COA / SDS

View Available Conjugates

Conjugate

Catalog #

Alexa Fluor 350

NBP2-50532AF350

Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-50532

Key Product Details

Species Reactivity

Applications

Label

Antibody Source

Format

Concentration

View all Enolase 2/Neuron-specific Enolase Antibodies »

Product Specifications

Immunogen

Specificity

Clonality

Host

Isotype

Scientific Data Images for Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free

Western Blot: Enolase 2/Neuron-specific Enolase Antibody (NSEP1)BSA Free [NBP2-50532]

Applications for Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free

ELISA

Immunohistochemistry

Western Blot

Formulation, Preparation, and Storage

Purification

Formulation

Format

Preservative

Concentration

Shipping

Stability & Storage

Background: Enolase 2/Neuron-specific Enolase

Alternate Names

Gene Symbol

Additional Enolase 2/Neuron-specific Enolase Products

Product Documents for Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free

Product Datasheets

COA

Certificate of Analysis

SDS

Product Specific Notices for Enolase 2/Neuron-specific Enolase Antibody (NSEP1) - BSA Free