ERP29 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88396

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88396
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Rat

Predicted:

Mouse (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all ERP29 Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD

Marker

Endoplasmic Reticulum Marker

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ERP29 Antibody

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining in human prostate and skeletal muscle tissues using anti-ERP29 antibody. Corresponding ERP29 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396]

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human cerebral cortex, lymph node, prostate and skeletal muscle using Anti-ERP29 antibody NBP1-88396 (A) shows similar protein distribution across tissues to independent antibody NBP1-88395 (B).
Western Blot: ERP29 Antibody [NBP1-88396]

Western Blot: ERP29 Antibody [NBP1-88396]

Western Blot: ERP29 Antibody [NBP1-88396] - Analysis using Anti-ERP29 antibody NBP1-88396 (A) shows similar pattern to independent antibody NBP1-88395 (B).
View 6 more images

Applications for ERP29 Antibody

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Immunogen affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ERP29

ERP29 encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Alternate Names

C12orf8chromosome 12 open reading frame 8, endoplasmic reticulum lumenal protein ERp28, endoplasmic reticulum protein 29, Endoplasmic reticulum resident protein 28, endoplasmic reticulum resident protein 29, ERp28Endoplasmic reticulum resident protein 31, ERp29, ERp31ERP28, PDIA9, PDI-DB, protein disulfide isomerase family A, member 9

Entrez Gene IDs

10961 (Human)

Gene Symbol

ERP29

UniProt

P30040 (Human)

Additional ERP29 Products

Product Documents for ERP29 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for ERP29 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.