Fatty acid desaturase 2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-82734

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-82734-0.1ml
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Fatty acid desaturase 2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human Fatty acid desaturase 2. Peptide sequence: VFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKF The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Fatty acid desaturase 2 Antibody

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734] - IHC - Paraffin (10 ug/ml)
Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734]

Immunohistochemistry-Paraffin: Fatty acid desaturase 2 Antibody [NBP2-82734] - IHC - Paraffin (10 ug/ml)

Applications for Fatty acid desaturase 2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Fatty acid desaturase 2

The protein encoded by the Fatty acid desaturase 2 gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq]

Long Name

Acyl-CoA 6-desaturase

Alternate Names

D6D, Delta(6) desaturase, Delta-6 desaturase, EC 1.14.19.3, FADS2

Gene Symbol

FADS2

Additional Fatty acid desaturase 2 Products

Product Documents for Fatty acid desaturase 2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Fatty acid desaturase 2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.