FGF-8 Antibody (2A10)

Novus Biologicals, part of Bio-Techne | Catalog # H00002253-M01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
H00002253-M01
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Sandwich ELISA, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2A10

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

View all FGF-8 Antibodies »

Product Specifications

Immunogen

FGF8 (NP_149354, 65 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Specificity

FGF8 (2A10)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for FGF-8 Antibody (2A10)

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in NIH/3T3.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10. Analysis of FGF8 expression in PC-12.
Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01]

Western Blot: FGF-8 Antibody (2A10) [H00002253-M01] - FGF8 monoclonal antibody (M01), clone 2A10 Analysis of FGF8 expression in HepG2.
View 3 more images

Applications for FGF-8 Antibody (2A10)

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for ELISA.
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FGF-8

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants.

Long Name

Fibroblast Growth Factor 8

Alternate Names

AIGF, FGF8, HBGF-8

Entrez Gene IDs

2253 (Human)

Gene Symbol

FGF8

OMIM

600483 (Human)

UniProt

NP_149354

Additional FGF-8 Products

Product Documents for FGF-8 Antibody (2A10)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FGF-8 Antibody (2A10)

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.