FKBP52/FKBP4 Antibody (3Q6H2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16387

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16387-100ul
NBP3-16387-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3Q6H2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all FKBP52 Antibodies »

Product Summary for FKBP52/FKBP4 Antibody (3Q6H2)

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human FKBP4 (Q02790). MTAEEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FKBP52/FKBP4 Antibody (3Q6H2)

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Western Blot: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Western blot analysis of extracts of various cell lines, using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Immunofluorescence analysis of U-2 OS cells using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/ Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387]

Immunocytochemistry/Immunofluorescence: FKBP52/FKBP4 Antibody (3Q6H2) [NBP3-16387] - Immunofluorescence analysis of NIH-3T3 cells using FKBP52/FKBP4 Rabbit mAb (NBP3-16387) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for FKBP52/FKBP4 Antibody (3Q6H2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: FKBP52

Hsp90 is crucial to cellular signaling by its regulation of the folding, activity, and stability of a wide range of client proteins. These client protein complexes may also contain one or more cochaperones (1). One class of Hsp90-binding cochaperone is composed of proteins with a characteristic tetratricopeptide repeat (TPR) domain that forms an Hsp90 binding site. Among the TPR cochaperones of Hsp90 are Hop/Sti1, protein phosphatase PP5, and members of both the FK506- and cyclosporin Abinding families of immunophilins (2). FK506-binding protein 51 (FKBP51) and FKBP52 are large molecular weight immunophilins that are part of the mature glucocorticoid receptor (GR) heterocomplex (3). The N terminal domain of each protein binds FK506 and has peptidyl-prolyl isomerase (PPIase) activity that converts prolyl peptide bonds within target proteins from cis- to trans- proline. The C-terminal domains contain the TPR repeats involved in protein-protein interactions with the Hsp90 (4). Although FKBP52 and FKBP51 share approx. 75% sequence similarity, they affect hormone binding by glucocorticoid receptor in opposing manners and have different Hsp90- binding characteristics (3, 5). Also, whereas FKBP51 typically has a role with the progesterone receptor, FKBP52 has been found to be linked to the progesterone, androgen and glucocorticoid receptors (5).

Long Name

52 kDa FK506 Binding Protein

Alternate Names

FKBP4, FKBP59, HBI, Hsp56

Gene Symbol

FKBP4

Additional FKBP52 Products

Product Documents for FKBP52/FKBP4 Antibody (3Q6H2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FKBP52/FKBP4 Antibody (3Q6H2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.