Flotillin-1 Antibody (8I2S7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16152

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16152-100ul
NBP3-16152-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8I2S7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Flotillin-1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 328-427 of human Flotillin-1 (O75955). GARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Flotillin-1 Antibody (8I2S7)

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Analysis of extracts of various cell lines, using Flotillin-1 Rabbit mAb (NBP3-16152) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Immunohistochemistry-Paraffin: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Immunohistochemistry-Paraffin: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Mouse heart using Flotillin-1 Rabbit mAb (NBP3-16152) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152]

Western Blot: Flotillin-1 Antibody (8I2S7) [NBP3-16152] - Analysis of extracts of various cell lines, using Flotillin-1 Rabbit mAb (NBP3-16152) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
View 2 more images

Applications for Flotillin-1 Antibody (8I2S7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Flotillin-1

Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.

Alternate Names

flotillin 1, flotillin-1, integral membrane component of caveolae

Gene Symbol

FLOT1

Additional Flotillin-1 Products

Product Documents for Flotillin-1 Antibody (8I2S7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Flotillin-1 Antibody (8I2S7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.