Forkhead box I2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-09207

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-09207-100ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Concentration

0.5 mg/ml

View all Forkhead box I2 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_899016). Peptide sequence FDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSE

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Forkhead box I2 Antibody

Western Blot: Forkhead box I2 Antibody [NBP3-09207]

Western Blot: Forkhead box I2 Antibody [NBP3-09207]

Western Blot: Forkhead box I2 Antibody [NBP3-09207] - Western blot analysis of Forkhead box I2 in NIH/3T3 cell lysate as a positive control. Antibody dilution at 0.2-1 ug/ml

Applications for Forkhead box I2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Forkhead box I2

Forkhead box I2 is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.

Alternate Names

FLJ46831, forkhead box I2, forkhead box protein I2, homolog of mouse Foxi2

Gene Symbol

FOXI2

Additional Forkhead box I2 Products

Product Documents for Forkhead box I2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Forkhead box I2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.