FUBI/MNSF beta/FAU Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-55090

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-55090
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all FUBI/MNSF beta Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to FAU(Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed) The peptide sequence was selected from the middle region of FAU. Peptide sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FUBI/MNSF beta/FAU Antibody

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - MCF7, Antibody Dilution: 1.0 ug/ml FAU is supported by BioGPS gene expression data to be expressed in MCF7.
Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Immunohistochemistry: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - Human Adult liver Observed Staining: Cytoplasmic Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 secProtocol located in Reviews and Data.
Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090]

Western Blot: FUBI/MNSF beta/FAU Antibody [NBP1-55090] - 721_B cell lysate, concentration 0.2-1 ug/ml.
View 2 more images

Applications for FUBI/MNSF beta/FAU Antibody

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:100-1:200

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FUBI/MNSF beta

FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

40S Ribosomal Protein S30, asr1, FAU, Fub1, MNSFbeta, RPS30, S30

Gene Symbol

FAU

UniProt

P62861 (Human)

Additional FUBI/MNSF beta Products

Product Documents for FUBI/MNSF beta/FAU Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for FUBI/MNSF beta/FAU Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.