GFR alpha-2/GDNF R alpha-2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-79553

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-79553
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all GFR alpha-2/GDNF R alpha-2 Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human GFRA2. Peptide sequence NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GFR alpha-2/GDNF R alpha-2 Antibody

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553]

Western Blot: GFR alpha-2/GDNF R alpha-2 Antibody [NBP1-79553] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Applications for GFR alpha-2/GDNF R alpha-2 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GFR alpha-2/GDNF R alpha-2

Members of the glial cell line derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN), play key roles in the control of vertebrate neuron survival and differentiation. Physiological responses to NTN require the presence of a novel glycosylphosphadidylinositol linked protein NTNRa, which is a cell surface receptor for NTN. The cDNAs encoding NTNRa from human, rat, chicken, and mouse have been cloned recently. NTNRa was also termed GDNFRb, Ret ligand 2 (RETL2) or TGFb related neurotrophic factor receptor 2 (TrnR2) and nominated as GFRa2 recently. GFRa2 binds NTN and mediates activation of RET receptor tyrosine kinase by both NTN and GDNF. Thus, NTN, GFRa2, and the Ret PTK form a complex to transduce NTN signal and to mediate NTN function.

Long Name

Glial Cell line-derived Neurotrophic Factor Receptor alpha 2

Alternate Names

GDNF R alpha-2, GFR alpha2, GFRa-2, GFRA2

Gene Symbol

GFRA2

UniProt

NP_001486 (Human)

Additional GFR alpha-2/GDNF R alpha-2 Products

Product Documents for GFR alpha-2/GDNF R alpha-2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GFR alpha-2/GDNF R alpha-2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.