GJC2 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-59263

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-59263
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

0.5 mg/ml

View all GJC2 Antibodies »

Product Summary for GJC2 Antibody

Immunogen

Synthetic peptides corresponding to GJC2(gap junction protein, gamma 2, 47kDa) The peptide sequence was selected from the middle region of GJC2. Peptide sequence APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GJC2 Antibody

Western Blot: GJC2 Antibody [NBP1-59263]

Western Blot: GJC2 Antibody [NBP1-59263]

Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human liver.
Immunohistochemistry: GJC2 Antibody [NBP1-59263]

Immunohistochemistry: GJC2 Antibody [NBP1-59263]

Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.
Western Blot: GJC2 Antibody [NBP1-59263]

Western Blot: GJC2 Antibody [NBP1-59263]

Western Blot: GJC2 Antibody [NBP1-59263] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
View 3 more images

Applications for GJC2 Antibody

Application
Recommended Usage

Immunohistochemistry

1:100

Western Blot

1.0 ug/ml
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GJC2

GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.This gene encodes a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans. Defects in this gene are the cause of autosomal recessive Pelizaeus-Merzbacher-like disease-1.

Alternate Names

connexin46.6, connexin-46.6, connexin-47, CX46.6, CX47, Gap junction alpha-12 protein, gap junction gamma-2 protein, gap junction protein, alpha 12, 47kDa, gap junction protein, gamma 2, 47kDa, GJA12connexin 47, HLD2, LMPH1C, PMLDAR, SPG44MGC105119

Gene Symbol

GJC2

UniProt

Q5T442 (Human)

Additional GJC2 Products

Product Documents for GJC2 Antibody

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for GJC2 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.