Glucosylceramidase/GBA Antibody (8O3Z7)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-15637

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-15637-100ul
NBP3-15637-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8O3Z7

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Glucosylceramidase/GBA Antibodies »

Product Summary for Glucosylceramidase/GBA Antibody (8O3Z7)

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase/GBA (P04062). VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glucosylceramidase/GBA Antibody (8O3Z7)

Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637] - Western blot analysis of extracts of various cell lines, using Glucosylceramidase beta (Glucosylceramidase/GBA) antibody (NBP3-15637) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Immunohistochemistry-Paraffin: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637] - Immunohistochemistry of paraffin-embedded human liver using Glucosylceramidase beta (Glucosylceramidase/GBA) Rabbit mAb (NBP3-15637) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]

Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637] - Western blot analysis of extracts of Rat brain, using Glucosylceramidase beta (Glucosylceramidase/GBA) antibody (NBP3-15637) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Applications for Glucosylceramidase/GBA Antibody (8O3Z7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000
Please Note: Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glucosylceramidase/GBA

GBA encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein.

Alternate Names

Alglucerase, GBA, GBA1, Imiglucerase

Gene Symbol

GBA1

Additional Glucosylceramidase/GBA Products

Product Documents for Glucosylceramidase/GBA Antibody (8O3Z7)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Glucosylceramidase/GBA Antibody (8O3Z7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.