Glutamate Dehydrogenase Antibody (7L7N2)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16582

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-16582-100ul
NBP3-16582-20ul
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7L7N2

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Glutamate Dehydrogenase 1/GLUD1 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 459-558 of human Glutamate Dehydrogenase (P00367). ERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutamate Dehydrogenase Antibody (7L7N2)

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Analysis of extracts of various cell lines, using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunocytochemistry/ Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunocytochemistry/Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunofluorescence analysis of NIH-3T3 cells using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunohistochemistry-Paraffin: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Mouse kidney using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
View 3 more images

Applications for Glutamate Dehydrogenase Antibody (7L7N2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 0.05% BSA, 50% glycerol, pH7.3

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutamate Dehydrogenase 1/GLUD1

One enzyme central to the metabolism of glutamate is glutamate dehydrogenase (GDH1; EC 1.4.1.3), that catalyzes the reversible deamination of L-glutamate to 2-oxoglutarate using NAD+ or NADP+. Mammalian GDH is composed of six identical subunits, and the regulation of GDH is very complex. It has been a major goal to identify the substrate and regulatory binding sites of GDH. It is only in recent years that the three-dimensional structure of GDH from microorganisms is available. Very recently, crystallization of bovine liver GDH was reported for the first time from the mammalian sources. However, remarkably little is known about the detailed structure of mammalian GDH, especially the brain enzymes.

Alternate Names

GDH, GDH1

Gene Symbol

GLUD1

Additional Glutamate Dehydrogenase 1/GLUD1 Products

Product Documents for Glutamate Dehydrogenase Antibody (7L7N2)

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Glutamate Dehydrogenase Antibody (7L7N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.